PDB entry 6xi7

View 6xi7 on RCSB PDB site
Description: Crystal Structure of wild-type KRAS (GMPPNP-bound) in complex with RAS-binding domain (RBD) and cysteine-rich domain (CRD) of RAF1/CRAF (crystal form I)
Class: ONCOPROTEIN, Transferase/Hydrolase
Keywords: KRAS, RAS, K-ras, KRAS4b, RAF1, CRAF, RBD, RAS-binding domain, cysteine-rich domain, CRD, ONCOPROTEIN, Transferase-Hydrolase complex
Deposited on 2020-06-19, released 2021-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-14, with a file datestamp of 2021-07-09.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Meleagris gallopavo [TaxId:9103]
    Gene: KRAS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P79800 (1-169)
      • expression tag (0)
      • engineered mutation (118)
    Domains in SCOPe 2.08: d6xi7a_
  • Chain 'B':
    Compound: raf proto-oncogene serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: RAF1, RAF
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GNP, MG, SO4, CL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6xi7A (A:)
gmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek

    Sequence, based on observed residues (ATOM records): (download) 
    >6xi7A (A:)
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek

  • Chain 'B':
    No sequence available.