PDB entry 6xh0

View 6xh0 on RCSB PDB site
Description: co-crystal structure of hiv-1 tar rna in complex with lab-evolved rrm tbp6.9
Deposited on 2020-06-18, released 2020-10-14
The last revision was dated 2020-12-16, with a file datestamp of 2020-12-11.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TAR binding protein 6.9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6XH0 (0-86)
  • Chain 'D':
    Compound: trans-activation response element
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6xh0A (A:)
gtrpnhtiyinnlnskikkdelkkslhaifsrfgqildilvprrrtprgqafvifkevss
atnalrsmqgfpfydkpmaiqyaktdr

  • Chain 'D':
    No sequence available.