SCOPe 2.08: Structural Classification of Proteins

PDB entry 6xgr

View 6xgr on RCSB PDB site
Description: ysd1 major tail protein
Deposited on 2020-06-17, released 2020-07-01
The last revision was dated 2020-08-12, with a file datestamp of 2020-08-07.
Experiment type: EM
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: YSD1_22 major tail protein
Species: Bacteriophage sp. [TaxId:38018]
Database cross-references and differences (RAF-indexed):
- Uniprot A0A498U5Z3
Chain 'B':
Compound: YSD1_22 major tail protein
Species: Bacteriophage sp. [TaxId:38018]
Database cross-references and differences (RAF-indexed):
- Uniprot A0A498U5Z3
Chain 'C':
Compound: YSD1_22 major tail protein
Species: Bacteriophage sp. [TaxId:38018]
Database cross-references and differences (RAF-indexed):
- Uniprot A0A498U5Z3
Chain 'D':
Compound: YSD1_22 major tail protein
Species: Bacteriophage sp. [TaxId:38018]
Database cross-references and differences (RAF-indexed):
- Uniprot A0A498U5Z3
Chain 'E':
Compound: YSD1_22 major tail protein
Species: Bacteriophage sp. [TaxId:38018]
Database cross-references and differences (RAF-indexed):
- Uniprot A0A498U5Z3
Chain 'F':
Compound: YSD1_22 major tail protein
Species: Bacteriophage sp. [TaxId:38018]
Database cross-references and differences (RAF-indexed):
- Uniprot A0A498U5Z3
Chain 'G':
Compound: YSD1_22 major tail protein
Species: Bacteriophage sp. [TaxId:38018]
Database cross-references and differences (RAF-indexed):
- Uniprot A0A498U5Z3
Chain 'H':
Compound: YSD1_22 major tail protein
Species: Bacteriophage sp. [TaxId:38018]
Database cross-references and differences (RAF-indexed):
- Uniprot A0A498U5Z3
Chain 'I':
Compound: YSD1_22 major tail protein
Species: Bacteriophage sp. [TaxId:38018]
Database cross-references and differences (RAF-indexed):
- Uniprot A0A498U5Z3
Chain 'J':
Compound: YSD1_22 major tail protein
Species: Bacteriophage sp. [TaxId:38018]
Database cross-references and differences (RAF-indexed):
- Uniprot A0A498U5Z3
Chain 'K':
Compound: YSD1_22 major tail protein
Species: Bacteriophage sp. [TaxId:38018]
Database cross-references and differences (RAF-indexed):
- Uniprot A0A498U5Z3
Chain 'L':
Compound: YSD1_22 major tail protein
Species: Bacteriophage sp. [TaxId:38018]
Database cross-references and differences (RAF-indexed):
- Uniprot A0A498U5Z3
Chain 'M':
Compound: YSD1_22 major tail protein
Species: Bacteriophage sp. [TaxId:38018]
Database cross-references and differences (RAF-indexed):
- Uniprot A0A498U5Z3
Chain 'N':
Compound: YSD1_22 major tail protein
Species: Bacteriophage sp. [TaxId:38018]
Database cross-references and differences (RAF-indexed):
- Uniprot A0A498U5Z3
Chain 'O':
Compound: YSD1_22 major tail protein
Species: Bacteriophage sp. [TaxId:38018]
Database cross-references and differences (RAF-indexed):
- Uniprot A0A498U5Z3
Chain 'P':
Compound: YSD1_22 major tail protein
Species: Bacteriophage sp. [TaxId:38018]
Database cross-references and differences (RAF-indexed):
- Uniprot A0A498U5Z3
Chain 'Q':
Compound: YSD1_22 major tail protein
Species: Bacteriophage sp. [TaxId:38018]
Database cross-references and differences (RAF-indexed):
- Uniprot A0A498U5Z3
Chain 'R':
Compound: YSD1_22 major tail protein
Species: Bacteriophage sp. [TaxId:38018]
Database cross-references and differences (RAF-indexed):
- Uniprot A0A498U5Z3

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

Chain 'A':
Sequence, based on SEQRES records:

>6xgrA (A:)
mndnyqnnyvvgrgtvyfdrfqdgtnrktgemyfgntpeftintdsetldhyssdhgmrv
mdasvlleasqggtftcdninadnlalwflgevsnttqtqqtdakevfnpimrgryyqlg
ttddnptgvrgvtnfqmvkadasiaisvgsgditsivgatvvnpagnyeidleagriyie
pdstdlsgnvqiavqydvdaqkrtlvigksnmvygalrmisdnpvglnknyyfpkvsiap
dgdyalkgddwqvmsftfkamqlnnitqrvyidiveaaaavdptaqrtieitpasttatt
ggagvvctvtvrdgtgtavqgdavtfttvagatvtpnsattgasgtatttvnrtaagtat
vtatlangkaattgtitfsap