PDB entry 6xcu

View 6xcu on RCSB PDB site
Description: NMR structure of Ost4V23D, a critical mutant of Ost4, in DPC micelles
Class: membrane protein
Keywords: transferase, membrane protein
Deposited on 2020-06-09, released 2021-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Oligosaccharyltransferase
  Species: Saccharomyces cerevisiae (strain YJM789) [TaxId:307796]
  Gene: OST4, SCY_0690
  Database cross-references and differences (RAF-indexed):
  • Uniprot A6ZXA2 (0-35)
    • engineered mutation (22)
    • expression tag (36-38)
  Domains in SCOPe 2.08: d6xcua1, d6xcua2

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6xcuA (A:)
  misdeqlnslaitfgivmmtlidiyhavdstmspknrlehhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6xcuA (A:)
  misdeqlnslaitfgivmmtlidiyhavdstmspknrle