PDB entry 6xcr

View 6xcr on RCSB PDB site
Description: NMR structure of Ost4 in DPC micelles
Class: membrane protein
Keywords: transferase, membrane protein
Deposited on 2020-06-09, released 2021-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oligosaccharyltransferase
    Species: Saccharomyces cerevisiae (strain YJM789) [TaxId:307796]
    Gene: OST4, SCY_0690
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6ZXA2 (0-35)
      • expression tag (36-38)
    Domains in SCOPe 2.08: d6xcra1, d6xcra2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6xcrA (A:)
    misdeqlnslaitfgivmmtliviyhavdstmspknrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xcrA (A:)
    misdeqlnslaitfgivmmtliviyhavdstmspknrle