PDB entry 6xbr

View 6xbr on RCSB PDB site
Description: Streptomyces coelicolor methylmalonyl-CoA epimerase (E43L) in complex with 2-nitronate-propionyl-CoA
Class: isomerase/inhibitor
Keywords: Methylmalonyl-CoA, epimerase, enol/enolate, enol/enolate analog, ISOMERASE, ISOMERASE-INHIBITOR complex
Deposited on 2020-06-07, released 2020-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-01, with a file datestamp of 2020-06-26.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylmalonyl-CoA Epimerase
    Species: Streptomyces coelicolor [TaxId:100226]
    Gene: SCO5398
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L2C2 (0-End)
      • engineered mutation (0)
      • engineered mutation (42)
    Domains in SCOPe 2.08: d6xbra_
  • Heterogens: KFV, CO, SO4, CL, NH4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6xbrA (A:)
    sltridhigiachdldatvefyratygfevfhtevneeqgvrlamlkindtsdggasylq
    lleptredsavgkwlakngegvhhiafgtadvdadaadirdkgvrvlydeprrgsmgsri
    tflhpkdchgvltelvtsaavespeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xbrA (A:)
    sltridhigiachdldatvefyratygfevfhtevneeqgvrlamlkindtsdggasylq
    lleptredsavgkwlakngegvhhiafgtadvdadaadirdkgvrvlydeprrgsmgsri
    tflhpkdchgvltelvtsaavesp