PDB entry 6xaw

View 6xaw on RCSB PDB site
Description: Crystal Structure Analysis of SIN3-UME6
Class: transcription
Keywords: RPD3 histone deacetylase complexes, pigenetic repression, TRANSCRIPTION
Deposited on 2020-06-04, released 2021-06-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-09, with a file datestamp of 2021-06-04.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transcriptional regulatory protein SIN3
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Gene: SIN3, CPE1, GAM2, RPD1, SDI1, SDS16, UME4, YOL004W
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22579 (Start-75)
  Domains in SCOPe 2.08: d6xawa_
• Chain 'B':
  Compound: Transcriptional regulatory protein UME6
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Gene: UME6, CAR80, CARGR1, NIM2, RIM16, YDR207C, YD8142.04C
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39001
• Heterogens: BR, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6xawA (A:)
  gphmknvdvefsqaisyvnkiktrfadqpdiykhfleilqtyqreqkpinevyaqvthlf
  qnapdlledfkkflpd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6xawA (A:)
  dvefsqaisyvnkiktrfadqpdiykhfleilqtyqreqkpinevyaqvthlfqnapdll
  edfkkflpd
  

  
  
• Chain 'B':
  No sequence available.