PDB entry 6x8x

View 6x8x on RCSB PDB site
Description: Cu-bound structure of an engineered metal-dependent protein trimer, TriCyt1
Class: metal binding protein
Keywords: four-helix bundle, metalloprotein trimer, METAL BINDING PROTEIN
Deposited on 2020-06-02, released 2020-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-12-16, with a file datestamp of 2020-12-11.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • conflict (58)
      • conflict (65)
      • conflict (69)
      • conflict (72)
      • conflict (76)
      • conflict (97)
      • conflict (100)
    Domains in SCOPe 2.08: d6x8xa_
  • Heterogens: CU, HEC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6x8xA (A:)
adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemhd
frhgfnilvwqihdalhlanegkvkeaqaaaeqlkttcnachqkyr