PDB entry 6x8n

View 6x8n on RCSB PDB site
Description: crystal structure of h49a able mutant
Deposited on 2020-06-01, released 2020-08-26
The last revision was dated 2020-09-23, with a file datestamp of 2020-09-18.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: De novo designed ABLE protein
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6X8N (0-125)
  • Chain 'B':
    Compound: De novo designed ABLE protein
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6X8N (0-125)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6x8nA (A:)
svkseyaeaaavgqeavavfntmkaafqngdkeavaqylarlaslytraeellnrileka
rregnkeavtlmneftatfqtgksifnamvaafkngdddsfesylqalekvtakgetlad
qiakal

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6x8nB (B:)
svkseyaeaaavgqeavavfntmkaafqngdkeavaqylarlaslytraeellnrileka
rregnkeavtlmneftatfqtgksifnamvaafkngdddsfesylqalekvtakgetlad
qiakal