PDB entry 6x5x

View 6x5x on RCSB PDB site
Description: Crystal structure o BmooMP-I, a P-I metalloproteinase from Bothrops moojeni
Class: hydrolase
Keywords: Metalloproteinase P-I, Fibrinogenolytic metalloproteinase, HYDROLASE
Deposited on 2020-05-27, released 2020-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-10-07, with a file datestamp of 2020-10-02.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Snake venom metalloproteinase BmooMP-I
    Species: Bothrops moojeni [TaxId:98334]
    Database cross-references and differences (RAF-indexed):
    • PDB 6X5X (0-199)
    Domains in SCOPe 2.08: d6x5xa_
  • Heterogens: ZN, CA, PG4, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6x5xA (A:)
    afspryielavvadngmftkynsnlntirtrvhemvntvngfyssvnanaslanlqvwsi
    kdlikvekdsnktltsfgewrerdllprishdhaqllttivfdnyvigrsrsgkmcdpeq
    svgvvrdhsknnlwvavtmahelghnldmhhddtcscgakscimasvlsktksyafstcs
    qneyqtfltkhnpqcilnep