PDB entry 6x4q

View 6x4q on RCSB PDB site
Description: Human cyclophilin A bound to a series of acylcic and macrocyclic inhibitors: (2R,5S,11S,14S,18E)-14-cyclobutyl-2,11,17,17-tetramethyl-15-oxa-3,9,12,26,29-pentaazatetracyclo[18.5.3.1~5,9~.0~23,27~]nonacosa-1(25),18,20(28),21,23,26-hexaene-4,10,13,16-tetrone (compound 33)
Class: isomerase/isomerase inhibitor
Keywords: Cyclophilin A, Sanglifehrin A, prolyl isomerase, macrocylcic inhibitor, peptidomimetic, ISOMERASE-ISOMERASE INHIBITOR complex
Deposited on 2020-05-22, released 2020-06-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-26, with a file datestamp of 2020-08-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIA, CYPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62937 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.08: d6x4qa1, d6x4qa2
  • Heterogens: UOJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6x4qA (A:)
    ghmvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriip
    gfmcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictak
    tewldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6x4qA (A:)
    hmvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipg
    fmcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakt
    ewldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgql