PDB entry 6x39

View 6x39 on RCSB PDB site
Description: Crystal structure of the FN5 domain of Mouse Lar
Class: cell adhesion
Keywords: Fibronectin type III, Receptor protein tyrosine phosphatase, CELL ADHESION
Deposited on 2020-05-21, released 2021-05-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-05-26, with a file datestamp of 2021-05-21.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor-type tyrosine-protein phosphatase F
    Species: Mus musculus [TaxId:10090]
    Gene: PTPRF, LAR
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2A8L5 (5-End)
      • expression tag (3-4)
    Domains in SCOPe 2.08: d6x39a1, d6x39a2
  • Heterogens: SOR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6x39A (A:)
gptsgsgpprkveveplnstavhvswklpvpnkqhgqirgyqvtyvrlengeprgqpiiq
dvmlaeaqettisgltpettysitvaayttkgdgarskpkvvtttgavp

    Sequence, based on observed residues (ATOM records): (download) 
    >6x39A (A:)
sgsgpprkveveplnstavhvswklpvphgqirgyqvtyvrlengeprgqpiiqdvmlae
aqettisgltpettysitvaayttkgdgarskpkvvtttg