PDB entry 6x1x

View 6x1x on RCSB PDB site
Description: pdz domain from choanoflagellate gipc (mbgipc)
Deposited on 2020-05-19, released 2020-11-25
The last revision was dated 2020-11-25, with a file datestamp of 2020-11-20.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mbGIPC protein
    Species: Monosiga brevicollis [TaxId:81824]
    Gene: 39217
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6x1xA (A:)
gpkgtektvkvikdgpalgltisdngagyafikkiredsimsrvanvavgdhiakingtd
lngcrhfevarmlkeipigseftmicvepkksfdei

    Sequence, based on observed residues (ATOM records):
    >6x1xA (A:)
gtektvkvikdgpalgltisdngagyafikkiredsimsrvanvavgdhiakingtdlng
crhfevarmlkeipigseftmicvepkksfdei