PDB entry 6x1p

View 6x1p on RCSB PDB site
Description: Crystal Structure of Choanoflagellate (Monosiga brevicollis) Dlg1 PDZ2 (mbDLG-2) in spacegroup I2
Class: signaling protein
Keywords: PDZ, protein-protein interaction, choanoflagellates, Monosiga brevicollis, peptide-binding domain, SIGNALING PROTEIN
Deposited on 2020-05-19, released 2020-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-11-25, with a file datestamp of 2020-11-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mbDLG protein
    Species: Monosiga brevicollis [TaxId:81824]
    Gene: 209
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9UT73 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d6x1pa1, d6x1pa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6x1pA (A:)
    gpetislhrqhgrglgftiaggqgsphiagddgifiskiipdsaakedgrlavgdrvlsv
    qgescekitheravemlrnpaspivlvvehnafhkataelsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6x1pA (A:)
    gpetislhrqhgrglgftiaggqgsphiagddgifiskiipdsaakedgrlavgdrvlsv
    qgescekitheravemlrnpaspivlvvehn