PDB entry 6x1n

View 6x1n on RCSB PDB site
Description: Crystal Structure of Choanoflagellate (Monosiga brevicollis) Dlg1 PDZ3 (mbDLG-3)
Class: signaling protein
Keywords: PDZ, Peptide-Binding Domain, Choanoflagellate, Signaling, SIGNALING PROTEIN
Deposited on 2020-05-19, released 2020-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-11-25, with a file datestamp of 2020-11-20.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mbDLG-3 protein
    Species: Monosiga brevicollis [TaxId:81824]
    Gene: 209
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6x1na_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6x1nA (A:)
kmsdlrtvtlykgkagfgfsllgpakagpaeegepvgifisrilpegaaiesgqvfegdq
ilsmngqdlalasyrqaanlvkhitdgvmtlnltanpgmydlykq