PDB entry 6wx8

View 6wx8 on RCSB PDB site
Description: SOX2 bound to Importin-alpha 3
Class: nuclear protein
Keywords: nuclear protein
Deposited on 2020-05-10, released 2020-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-01-20, with a file datestamp of 2021-01-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Importin subunit alpha-3
    Species: Homo sapiens [TaxId:9606]
    Gene: KPNA4, QIP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6wx8a_
  • Chain 'B':
    Compound: transcription factor sox-2
    Species: Homo sapiens [TaxId:9606]
    Gene: SOX2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6wx8b_
  • Chain 'C':
    Compound: Importin subunit alpha-3
    Species: Homo sapiens [TaxId:9606]
    Gene: KPNA4, QIP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6wx8c_
  • Chain 'D':
    Compound: transcription factor sox-2
    Species: Homo sapiens [TaxId:9606]
    Gene: SOX2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6wx8d_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6wx8A (A:)
    sgdyrvqntsleaivqnassdnqgiqlsavqaarkllssdrnppiddliksgilpilvhc
    lerddnpslqfeaawaltniasgtseqtqavvqsnavplflrllhsphqnvceqavwalg
    niigdgpqcrdyvislgvvkpllsfispsipitflrnvtwvmvnlcrhkdppppmetiqe
    ilpalcvlihhtdvnilvdtvwalsyltdagneqiqmvidsgivphlvpllshqevkvqt
    aalravgnivtgtdeqtqvvlncdalshfpallthpkekinkeavwflsnitagnqqqvq
    avidanlvpmiihlldkgdfgtqkeaawaisnltisgrkdqvayliqqnvippfcnlltv
    kdaqvvqvvldglsnilkmaedeaetignlieecgglekieqlqnhenediyklayeiid
    qffssddidedpslvpeaiqggtfgfnssanvptegfqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6wx8A (A:)
    rvqntsleaivqnassdnqgiqlsavqaarkllssdrnppiddliksgilpilvhclerd
    dnpslqfeaawaltniasgtseqtqavvqsnavplflrllhsphqnvceqavwalgniig
    dgpqcrdyvislgvvkpllsfispsipitflrnvtwvmvnlcrhkdppppmetiqeilpa
    lcvlihhtdvnilvdtvwalsyltdagneqiqmvidsgivphlvpllshqevkvqtaalr
    avgnivtgtdeqtqvvlncdalshfpallthpkekinkeavwflsnitagnqqqvqavid
    anlvpmiihlldkgdfgtqkeaawaisnltisgrkdqvayliqqnvippfcnlltvkdaq
    vvqvvldglsnilkmaedeaetignlieecgglekieqlqnhenediyklayeiidqff
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6wx8B (B:)
    sdrvkrpmnafmvwsrgqrrkmaqenpkmhnseiskrlgaewkllsetekrpfideakrl
    ralhmkehpdykyrprrktktlmkkdkytl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6wx8B (B:)
    drvkrpmnafmvwsrgqrrkmaqenpkmhnseiskrlgaewkllsetekrpfideakrlr
    alhmkehpdykyrprrktktlm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6wx8C (C:)
    sgdyrvqntsleaivqnassdnqgiqlsavqaarkllssdrnppiddliksgilpilvhc
    lerddnpslqfeaawaltniasgtseqtqavvqsnavplflrllhsphqnvceqavwalg
    niigdgpqcrdyvislgvvkpllsfispsipitflrnvtwvmvnlcrhkdppppmetiqe
    ilpalcvlihhtdvnilvdtvwalsyltdagneqiqmvidsgivphlvpllshqevkvqt
    aalravgnivtgtdeqtqvvlncdalshfpallthpkekinkeavwflsnitagnqqqvq
    avidanlvpmiihlldkgdfgtqkeaawaisnltisgrkdqvayliqqnvippfcnlltv
    kdaqvvqvvldglsnilkmaedeaetignlieecgglekieqlqnhenediyklayeiid
    qffssddidedpslvpeaiqggtfgfnssanvptegfqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6wx8C (C:)
    ntsleaivqnassdnqgiqlsavqaarkllssdrnppiddliksgilpilvhclerddnp
    slqfeaawaltniasgtseqtqavvqsnavplflrllhsphqnvceqavwalgniigdgp
    qcrdyvislgvvkpllsfispsipitflrnvtwvmvnlcrhkdppppmetiqeilpalcv
    lihhtdvnilvdtvwalsyltdagneqiqmvidsgivphlvpllshqevkvqtaalravg
    nivtgtdeqtqvvlncdalshfpallthpkekinkeavwflsnitagnqqqvqavidanl
    vpmiihlldkgdfgtqkeaawaisnltisgrkdqvayliqqnvippfcnlltvkdaqvvq
    vvldglsnilkmaedeaetignlieecgglekieqlqnhenediyklayeiidqffs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6wx8D (D:)
    sdrvkrpmnafmvwsrgqrrkmaqenpkmhnseiskrlgaewkllsetekrpfideakrl
    ralhmkehpdykyrprrktktlmkkdkytl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6wx8D (D:)
    rvkrpmnafmvwsrgqrrkmaqenpkmhnseiskrlgaewkllsetekrpfideakrlra
    lhmkehpdykyrprrktktlm