PDB entry 6ww3

View 6ww3 on RCSB PDB site
Description: crystal structure of herc2 zz domain in complex with sumo1 tail
Deposited on 2020-05-07, released 2020-08-05
The last revision was dated 2020-11-11, with a file datestamp of 2020-11-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: SUMO1 linked HERC2 ZZ domain (Small ubiquitin-related modifier 1,E3 ubiquitin-protein ligase HERC2)
  Species: Homo sapiens [TaxId:9606]
  Gene: HERC2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63165 (0-5)
  • Uniprot O95714 (6-59)
• Chain 'B':
  Compound: SUMO1 linked HERC2 ZZ domain (Small ubiquitin-related modifier 1,E3 ubiquitin-protein ligase HERC2)
  Species: Homo sapiens [TaxId:9606]
  Gene: HERC2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63165 (0-5)
  • Uniprot O95714 (6-End)
• Heterogens: ZN, PEG, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6ww3A (A:)
  sdqeakihpgvtcdgcqmfpingsrfkcrncddfdfcetcfktkkhntrhtfgrinepgq
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records:
  

  >6ww3B (B:)
  sdqeakihpgvtcdgcqmfpingsrfkcrncddfdfcetcfktkkhntrhtfgrinepgq
  

  
  Sequence, based on observed residues (ATOM records):
  

  >6ww3B (B:)
  sdqeakihpgvtcdgcqmfpingsrfkcrncddfdfcetcfktkkhntrhtfgrinep