PDB entry 6wur

View 6wur on RCSB PDB site
Description: Crystal structure of PRL-2 phosphatase C101D mutant in complex with the Bateman domain of CNNM3 magnesium transporter
Class: metal transport/hydrolase
Keywords: phosphatase, magnesium transporter, protein binding, METAL TRANSPORT, METAL TRANSPORT-HYDROLASE complex
Deposited on 2020-05-05, released 2020-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-01, with a file datestamp of 2020-06-26.
Experiment type: XRAY
Resolution: 2.88 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein tyrosine phosphatase type IVA 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PTP4A2, PRL2, PTPCAAX2, BM-008
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12974 (22-End)
      • expression tag (18-21)
      • engineered mutation (122)
    Domains in SCOPe 2.08: d6wura1, d6wura2
  • Chain 'B':
    Compound: Metal transporter CNNM3
    Species: Homo sapiens [TaxId:9606]
    Gene: CNNM3, ACDP3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NE01 (11-End)
      • expression tag (0-10)
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6wurA (A:)
msyyhhhhhhlestslykkagfmnrpapveisyenmrflithnptnatlnkfteelkkyg
vttlvrvcdatydkapvekegihvldwpfddgapppnqivddwlnllktkfreepgccva
vhdvaglgrapvlvalaliecgmkyedavqfirqkrrgafnskqllylekyrpkmrlrfr
dtnghccvq

    Sequence, based on observed residues (ATOM records): (download) 
    >6wurA (A:)
kagfmnrpapveisyenmrflithnptnatlnkfteelkkygvttlvrvcdatydkapve
kegihvldwpfddgapppnqivddwlnllktkfreepgccvavhdvaglgrapvlvalal
iecgmkyedavqfirqkrrgafnskqllylekyrpkmr

  • Chain 'B':
    No sequence available.