PDB entry 6woc

View 6woc on RCSB PDB site
Description: Diphosphoinositol polyphosphate phosphohydrolase 1 (DIPP1/NUDT3) in complex with 5-diphosphoinositol pentakisphosphate and Mg, presoaked with 5-IP7, Mg and Fluoride, soaking 1min in the absence of Fluoride.
Class: hydrolase
Keywords: phosphatase, nudix, catalysis mechanism, Substrate Specificity, inositol, inositol pyrophosphate, HYDROLASE
Deposited on 2020-04-24, released 2021-03-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Diphosphoinositol polyphosphate phosphohydrolase 1
  Species: Homo sapiens [TaxId:9606]
  Gene: NUDT3, DIPP, DIPP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O95989
  Domains in SCOPe 2.07: d6woca_
• Heterogens: CL, I7P, MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6wocA (A:)
  hhhhhhssgvdlgtenlyfqsmmklksnqtrtydgdgykkraaclcfrseseeevllvss
  srhpdrwivpgggmepeeepsvaavrevceeagvkgtlgrlvgifenqerkhrtyvyvli
  vtevledwedsvnigrkrewfkiedaikvlqyhkpvqasyfetlrqgys
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6wocA (A:)
  trtydgdgykkraaclcfrseseeevllvsssrhpdrwivpgggmepeeepsvaavrevc
  eeagvkgtlgrlvgifenqerkhrtyvyvlivtevledwedsvnigrkrewfkiedaikv
  lqyhkpvqasyfet