PDB entry 6wio

View 6wio on RCSB PDB site
Description: Fab antigen complex
Class: cytokine/immune system
Keywords: Fab, Il-17, CYTOKINE, CYTOKINE-IMMUNE SYSTEM complex
Deposited on 2020-04-10, released 2020-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-09-30, with a file datestamp of 2020-09-25.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6WIO (0-229)
  • Chain 'B':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6WIO (0-212)
    Domains in SCOPe 2.07: d6wiob1, d6wiob2
  • Chain 'C':
    Compound: interleukin-17a
    Species: Homo sapiens [TaxId:9606]
    Gene: IL17A, CTLA8, IL17
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16552 (Start-154)
      • expression tag (155-160)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6wioB (B:)
eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfavyycqqygsspctfgqgtrleikrtvaapsvfifp
psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
tlskadyekhkvyacevtqgttsvtksfnrgec

  • Chain 'C':
    No sequence available.