PDB entry 6wgv

View 6wgv on RCSB PDB site
Description: Mycobacterium tuberculosis pduO-type ATP:cobalamin adenosyltransferase bound to adenosylcobalamin and PPPi
Class: transferase
Keywords: chaperone, B12 trafficking, TRANSFERASE
Deposited on 2020-04-06, released 2021-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-01-20, with a file datestamp of 2021-01-15.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Corrinoid adenosyltransferase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: E5M05_13560, ERS023446_03354, ERS027651_01619, FCN16_21305, SAMEA2682864_01680, SAMEA2683035_01578
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6wgva_
  • Heterogens: 3PO, 5AD, B12, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6wgvA (A:)
    gshmavhltriytrtgddgttglsdmsrvaktdarlvayadcdeanaaigaalalghpdt
    qitdvlrqiqndlfdagadlstpivenpkhpplriaqsyidrlegwcdaynaglpalksf
    vlpggsplsallhvartvvrraersawaavdahpegvsvlpakylnrlsdllfilsrvan
    pdgdvlwrpggdrtas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6wgvA (A:)
    dgttglsdmsrvaktdarlvayadcdeanaaigaalalghpdtqitdvlrqiqndlfdag
    adlstpivenpkhpplriaqsyidrlegwcdaynaglpalksfvlpggsplsallhvart
    vvrraersawaavdahpegvsvlpakylnrlsdllfilsrvanpdgdvlwrpg