PDB entry 6wfn

View 6wfn on RCSB PDB site
Description: Crystal structure of human Naa50 in complex with AcCoA and an inhibitor (compound 4a) identified using DNA encoded library technology
Class: transferase/inhibitor
Keywords: N-alpha-acetyltransferase 50, Inhibitor complex, DNA encoded library, AcCoA, TRANSFERASE, TRANSFERASE-INHIBITOR complex
Deposited on 2020-04-03, released 2020-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-01, with a file datestamp of 2020-06-26.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: N/A
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-alpha-acetyltransferase 50
    Species: Homo sapiens [TaxId:9606]
    Gene: NAA50, MAK3, NAT13, NAT5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6wfna_
  • Heterogens: U2J, ACO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6wfnA (A:)
gsmkgsrielgdvtphnikqlkrlnqvifpvsyndkfykdvlevgelaklayfndiavga
vccrvdhsqnqkrlyimtlgclapyrrlgigtkmlnhvlnicekdgtfdniylhvqisne
saidfyrkfgfeiietkknyykriepadahvlqknlkvpsgqnadvqktdn

    Sequence, based on observed residues (ATOM records): (download) 
    >6wfnA (A:)
srielgdvtphnikqlkrlnqvifpvsyndkfykdvlevgelaklayfndiavgavccrv
dhsqnqkrlyimtlgclapyrrlgigtkmlnhvlnicekdgtfdniylhvqisnesaidf
yrkfgfeiietkknyykriepadahvlqknl