PDB entry 6wes

View 6wes on RCSB PDB site
Description: crystal structure of the effector sntox3 from parastagonospora nodorum
Deposited on 2020-04-02, released 2020-11-04
The last revision was dated 2021-09-01, with a file datestamp of 2021-08-27.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: N/A
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tox3
    Species: Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) [TaxId:321614]
    Gene: Tox3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6wesA (A:)
yikandinfgtrsvhdcrertgiqrdvkvradipfetddgpnqvlrvtwsnalnvdrfdp
lpivtvpgnaasttitaihdfclmnpttspptrclyqlrqpftlgfdrtrmhnniyltpp
npqrptmhevciradecpagrvflecstrtygaiprge