PDB entry 6we0

View 6we0 on RCSB PDB site
Description: wheat dwarf virus rep domain complexed with a single-stranded dna 10- mer comprising the cleavage site
Deposited on 2020-04-01, released 2020-12-16
The last revision was dated 2021-03-17, with a file datestamp of 2021-03-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replication-associated protein
    Species: Wheat dwarf virus [TaxId:10834]
    Gene: REPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7KQY4
      • engineered mutation (105)
  • Chain 'C':
    Compound: DNA (5'-d(*tp*ap*ap*tp*ap*tp*tp*ap*cp*c)-3')
    Species: Wheat dwarf virus, synthetic [TaxId:10834]
  • Heterogens: MN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6we0A (A:)
massstprfrvyskylfltypqctlepqyaldslrtllnkyeplyiaavrelhedgsphl
hvlvqnklrasitnpnalnlrmdtspfsifhpniqaakdcnqvrdfitkevdsdvntaew
gtfvavstpgrkdrdad

    Sequence, based on observed residues (ATOM records):
    >6we0A (A:)
rfrvyskylfltypqctlepqyaldslrtllnkyeplyiaavrelhedgsphlhvlvqnk
lrasitnpnalnlrmdtspfsifhpniqaakdcnqvrdfitkevdsdvntaewgtfvav

  • Chain 'C':
    No sequence available.