PDB entry 6wco

View 6wco on RCSB PDB site
Description: Structure of SARS main protease bound to inhibitor X47
Class: viral protein/inhibitor
Keywords: COVID-19, SARS, SARS-CoV, main protease, 3C-like protease, 3CL protease, 3Clpro, Mpro, broad-spectrum, inhibitor, proteinase, non-covalent, reversible, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, ANTIVIRAL PROTEIN, VIRAL PROTEIN, VIRAL PROTEIN-INHIBITOR complex
Deposited on 2020-03-30, released 2020-08-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-05, with a file datestamp of 2020-07-31.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: main protease
    Species: SARS coronavirus Urbani [TaxId:228330]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6wcoa_
  • Heterogens: X47, MES, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6wcoA (A:)
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sgvtfq