PDB entry 6way

View 6way on RCSB PDB site
Description: c-terminal sh2 domain of p120rasgap in complex with p190rhogap phosphotyrosine peptide
Deposited on 2020-03-26, released 2020-06-17
The last revision was dated 2020-08-12, with a file datestamp of 2020-08-07.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras GTPase-activating protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RASA1, GAP, RASA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20936 (2-106)
      • expression tag (1)
      • engineered mutation (34)
      • engineered mutation (64)
  • Chain 'V':
    Compound: Rho GTPase-activating protein 35
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PTR, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6wayA (A:)
gsgreedphegkiwfhgkiskqeaynllmtvgqvssflvrpsdntpgdyslyfrtneniq
rfkisptpnnqfmmggryynsigdiidhyrkeqivegyylkepvpmq

    Sequence, based on observed residues (ATOM records):
    >6wayA (A:)
sgreedphegkiwfhgkiskqeaynllmtvgqvssflvrpsdntpgdyslyfrtneniqr
fkisptpnnqfmmggryynsigdiidhyrkeqivegyylkepvpmq

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records:
    >6wayV (V:)
dyaepmda