PDB entry 6w9w

View 6w9w on RCSB PDB site
Description: R80A PCNA mutant defective in BIR
Class: DNA binding protein
Keywords: BIR, break induced replication, DNA repair, DNA damage, PCNA, proliferating cellular nuclear antigen, DNA BINDING PROTEIN
Deposited on 2020-03-23, released 2020-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-09-23, with a file datestamp of 2020-09-18.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: POL30, YBR088C, YBR0811
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15873 (2-255)
      • expression tag (0-1)
      • engineered mutation (81)
    Domains in SCOPe 2.07: d6w9wa1, d6w9wa2, d6w9wa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6w9wA (A:)
    hhmleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafq
    eyrcdhpvtlgmdltslskilacgnntdtltliadntpdsiillfedtkkdriaeyslkl
    mdidadflkieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsg
    sviikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfq
    fdlksgflqfflapkf