PDB entry 6w6q

View 6w6q on RCSB PDB site
Description: wt htlv-1 protease in complex with darunavir (drv)
Deposited on 2020-03-17, released 2021-03-17
The last revision was dated 2021-03-17, with a file datestamp of 2021-03-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HTLV-1 Protease
    Species: Human T-cell leukemia virus type I [TaxId:11908]
    Gene: pro
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: HTLV-1 Protease
    Species: Human T-cell leukemia virus type I [TaxId:11908]
    Gene: pro
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 017, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6w6qA (A:)
pvipldparrpvikaqvdtqtshpktiealldtgadmtvipialfssntplkntsvlgag
gqtqdhfkltslpvlirlpfrttpivltsclvdtknnwaiigrdalqqcqgvlylp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6w6qB (B:)
pvipldparrpvikaqvdtqtshpktiealldtgadmtvipialfssntplkntsvlgag
gqtqdhfkltslpvlirlpfrttpivltsclvdtknnwaiigrdalqqcqgvlylp