PDB entry 6w0v
View 6w0v on RCSB PDB site
Description: The Crystal Structure of the Mutant Nuclease Domain of Pyocin S8 with its Cognate Immunity Protein
Class: antimicrobial protein
Keywords: protein antibiotic, H-H-N DNase, toxin, ANTIMICROBIAL PROTEIN
Deposited on
2020-03-03, released
2020-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated
2020-10-21, with a file datestamp of
2020-10-16.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.63
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Pyocin S8
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: pys8, TN6350_00005
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d6w0va_ - Chain 'B':
Compound: bacteriocin immunity protein
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: E4V10_35375, EQH76_05885, F3H14_26645
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d6w0vb_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>6w0vA (A:)
depgvatgngqpvtgnwlagasqgdgvpipsqiadqlrgkefkswrdfreqfwvavandp
elvkyfrktnakgmrdglspftpkaeqaggrdkyaihhvvqisqggavydidnlrvmtpk
mhiqv
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>6w0vB (B:)
skkisdhteaeffsliselfnrsfssekerdvvvyaivnaaqhpdgtdiifypkedeeds
pegvlkrikewraanglpgfka