PDB entry 6w0v

View 6w0v on RCSB PDB site
Description: The Crystal Structure of the Mutant Nuclease Domain of Pyocin S8 with its Cognate Immunity Protein
Class: antimicrobial protein
Keywords: protein antibiotic, H-H-N DNase, toxin, ANTIMICROBIAL PROTEIN
Deposited on 2020-03-03, released 2020-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-10-21, with a file datestamp of 2020-10-16.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyocin S8
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: pys8, TN6350_00005
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1P8L021 (0-124)
      • engineered mutation (94)
    Domains in SCOPe 2.08: d6w0va_
  • Chain 'B':
    Compound: bacteriocin immunity protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: E4V10_35375, EQH76_05885, F3H14_26645
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A3S3UAR3 (0-81)
      • engineered mutation (6)
    Domains in SCOPe 2.08: d6w0vb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6w0vA (A:)
    depgvatgngqpvtgnwlagasqgdgvpipsqiadqlrgkefkswrdfreqfwvavandp
    elvkyfrktnakgmrdglspftpkaeqaggrdkyaihhvvqisqggavydidnlrvmtpk
    mhiqv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6w0vB (B:)
    skkisdhteaeffsliselfnrsfssekerdvvvyaivnaaqhpdgtdiifypkedeeds
    pegvlkrikewraanglpgfka