PDB entry 6vsi

View 6vsi on RCSB PDB site
Description: Crystal structure of FKBP12 of Candida auris
Class: isomerase
Keywords: FKBP12, C. auris, pathogenesis, ISOMERASE
Deposited on 2020-02-11, released 2020-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-29, with a file datestamp of 2020-04-24.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidylprolyl isomerase
    Species: Candida auris [TaxId:498019]
    Gene: CJJ09_002997
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6vsia_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6vsiA (A:)
mapntteveiisegdgkvfpkvgdtvtihytgtlengkkfdssrdrgkpfqctigvghvi
kgwdigipklsvgsqakltipgheaygsrgfpglippdatlifdvellgvn