PDB entry 6vrj

View 6vrj on RCSB PDB site
Description: Solution structure of Pseudomonas aeruginosa IF3 C-terminal domain
Class: translation
Keywords: translation initiation factor 3, TRANSLATION
Deposited on 2020-02-07, released 2021-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor IF-3
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: infC, IPC47_09970
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6vrja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6vrjA (A:)
vakknqkqaqvkeikfrpgteegdyqvklrnlvrflsegdkakvslrfrgremahqelgm
ellkrveadlveygtveqhpklegrqlmmviapkkkk