PDB entry 6vqv

View 6vqv on RCSB PDB site
Description: Type I-F CRISPR-Csy complex with its inhibitor AcrF9
Class: RNA binding protein/RNA/inhibitor
Keywords: CRISPR, Type I-F, Csy, AcrF9, anti-CRISPR, RNA BINDING PROTEIN-RNA-INHIBITOR complex
Deposited on 2020-02-06, released 2020-03-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-15, with a file datestamp of 2020-04-10.
Experiment type: EM
Resolution: 2.57 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: AcrF9
  Species: Pseudomonas aeruginosa [TaxId:287]
  Database cross-references and differences (RAF-indexed):
  • PDB 6VQV (0-67)
• Chain 'B':
  Compound: AcrF9
  Species: Pseudomonas aeruginosa [TaxId:287]
  Database cross-references and differences (RAF-indexed):
  • PDB 6VQV (0-67)
• Chain 'C':
  Compound: CRISPR-associated protein Csy1
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: csy1, PA14_33330
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02ML9 (Start-433)
• Chain 'D':
  Compound: CRISPR-associated protein Csy2
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: csy2, ALP65_00953, EQH76_13810, FCG96_17775, PACL_0128
  Database cross-references and differences (RAF-indexed):
  • Uniprot B3G161
• Chain 'E':
  Compound: CRISPR-associated protein Csy3
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: EQH76_13805, FCG96_17770
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A444M080
• Chain 'F':
  Compound: CRISPR-associated protein Csy3
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: EQH76_13805, FCG96_17770
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A444M080
• Chain 'G':
  Compound: CRISPR-associated protein Csy3
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: EQH76_13805, FCG96_17770
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A444M080
• Chain 'H':
  Compound: CRISPR-associated protein Csy3
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: EQH76_13805, FCG96_17770
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A444M080
• Chain 'I':
  Compound: CRISPR-associated protein Csy3
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: EQH76_13805, FCG96_17770
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A444M080
• Chain 'J':
  Compound: CRISPR-associated protein Csy3
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: EQH76_13805, FCG96_17770
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A444M080 (Start-359)
• Chain 'K':
  Compound: CRISPR-associated endonuclease Cas6/Csy4
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: cas6f, csy4, PA14_33300
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02MM2 (0-186)
  Domains in SCOPe 2.08: d6vqvk1, d6vqvk2
• Chain 'L':
  Compound: CrRNA (60-MER)
  Species: Pseudomonas aeruginosa [TaxId:287]
  

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6vqvK (K:)
  mdhyldirlrpdpefppaqlmsvlfgklhqalvaqggdrigvsfpdldesrsrlgerlri
  hasaddlrallarpwleglrdhlqfgepavvphptpyrqvsrvqaksnperlrrrlmrrh
  dlseeearkripdtvaraldlpfvtlrsqstgqhfrlfirhgplqvtaeeggftcyglsk
  ggfvpwf
  

  
  
• Chain 'L':
  No sequence available.