PDB entry 6vme

View 6vme on RCSB PDB site
Description: Human ESCRT-I heterotetramer headpiece
Class: protein transport
Keywords: Endosomal transport, HIV release, macroautophagy, PROTEIN TRANSPORT
Deposited on 2020-01-27, released 2020-05-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-06-24, with a file datestamp of 2020-06-19.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Multivesicular body subunit 12A
    Species: Homo sapiens [TaxId:9606]
    Gene: MVB12A, CFBP, FAM125A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96EY5 (2-End)
      • expression tag (0-1)
  • Chain 'B':
    Compound: Tumor susceptibility gene 101 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TSG101
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Vacuolar protein sorting-associated protein 37B
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS37B
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Multivesicular body subunit 12A
    Species: Homo sapiens [TaxId:9606]
    Gene: MVB12A, CFBP, FAM125A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96EY5 (2-End)
      • expression tag (1)
  • Chain 'E':
    Compound: Vacuolar protein sorting-associated protein 28 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6vmee_
  • Chain 'F':
    Compound: Tumor susceptibility gene 101 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TSG101
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Tumor susceptibility gene 101 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TSG101
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Tumor susceptibility gene 101 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TSG101
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Tumor susceptibility gene 101 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TSG101
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Tumor susceptibility gene 101 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TSG101
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Vacuolar protein sorting-associated protein 37B
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS37B
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Vacuolar protein sorting-associated protein 37B
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS37B
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Vacuolar protein sorting-associated protein 37B
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS37B
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Vacuolar protein sorting-associated protein 37B
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS37B
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Vacuolar protein sorting-associated protein 37B
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS37B
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Multivesicular body subunit 12A
    Species: Homo sapiens [TaxId:9606]
    Gene: MVB12A, CFBP, FAM125A
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: Multivesicular body subunit 12A
    Species: Homo sapiens [TaxId:9606]
    Gene: MVB12A, CFBP, FAM125A
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: Multivesicular body subunit 12A
    Species: Homo sapiens [TaxId:9606]
    Gene: MVB12A, CFBP, FAM125A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96EY5 (2-End)
      • expression tag (0-1)
  • Chain 'T':
    Compound: Multivesicular body subunit 12A
    Species: Homo sapiens [TaxId:9606]
    Gene: MVB12A, CFBP, FAM125A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96EY5 (2-End)
      • expression tag (1)
  • Chain 'U':
    Compound: Vacuolar protein sorting-associated protein 28 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6vmeu_
  • Chain 'V':
    Compound: Vacuolar protein sorting-associated protein 28 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6vmev_
  • Chain 'W':
    Compound: Vacuolar protein sorting-associated protein 28 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6vmew_
  • Chain 'X':
    Compound: Vacuolar protein sorting-associated protein 28 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6vmex_
  • Chain 'Y':
    Compound: Vacuolar protein sorting-associated protein 28 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6vmey_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >6vmeE (E:)
mfhgipatpgigapgnkpelyeevklyknarerekydnmaelfavvktmqalekayikdc
vspseytaacsrllvqykaafrqvqgseissidefcrkfrldcplamerikedrpitikd
dk

    Sequence, based on observed residues (ATOM records): (download) 
    >6vmeE (E:)
nkpelyeevklyknarerekydnmaelfavvktmqalekayikdcvspseytaacsrllv
qykaafrqvqgseissidefcrkfrldcplamerikedrpit

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    Sequence, based on SEQRES records: (download) 
    >6vmeU (U:)
mfhgipatpgigapgnkpelyeevklyknarerekydnmaelfavvktmqalekayikdc
vspseytaacsrllvqykaafrqvqgseissidefcrkfrldcplamerikedrpitikd
dk

    Sequence, based on observed residues (ATOM records): (download) 
    >6vmeU (U:)
kpelyeevklyknarerekydnmaelfavvktmqalekayikdcvspseytaacsrllvq
ykaafrqvqgseissidefcrkfrldcplamerikedrpiti

  • Chain 'V':
    Sequence, based on SEQRES records: (download) 
    >6vmeV (V:)
mfhgipatpgigapgnkpelyeevklyknarerekydnmaelfavvktmqalekayikdc
vspseytaacsrllvqykaafrqvqgseissidefcrkfrldcplamerikedrpitikd
dk

    Sequence, based on observed residues (ATOM records): (download) 
    >6vmeV (V:)
gnkpelyeevklyknarerekydnmaelfavvktmqalekayikdcvspseytaacsrll
vqykaafrqvqgseissidefcrkfrldcplamerikedrpiti

  • Chain 'W':
    Sequence, based on SEQRES records: (download) 
    >6vmeW (W:)
mfhgipatpgigapgnkpelyeevklyknarerekydnmaelfavvktmqalekayikdc
vspseytaacsrllvqykaafrqvqgseissidefcrkfrldcplamerikedrpitikd
dk

    Sequence, based on observed residues (ATOM records): (download) 
    >6vmeW (W:)
pgnkpelyeevklyknarerekydnmaelfavvktmqalekayikdcvspseytaacsrl
lvqykaafrqvqgseissidefcrkfrldcplamerikedrpiti

  • Chain 'X':
    Sequence, based on SEQRES records: (download) 
    >6vmeX (X:)
mfhgipatpgigapgnkpelyeevklyknarerekydnmaelfavvktmqalekayikdc
vspseytaacsrllvqykaafrqvqgseissidefcrkfrldcplamerikedrpitikd
dk

    Sequence, based on observed residues (ATOM records): (download) 
    >6vmeX (X:)
pelyeevklyknarerekydnmaelfavvktmqalekayikdcvspseytaacsrllvqy
kaafrqvqgseissidefcrkfrldcplamerikedrpiti

  • Chain 'Y':
    Sequence, based on SEQRES records: (download) 
    >6vmeY (Y:)
mfhgipatpgigapgnkpelyeevklyknarerekydnmaelfavvktmqalekayikdc
vspseytaacsrllvqykaafrqvqgseissidefcrkfrldcplamerikedrpitikd
dk

    Sequence, based on observed residues (ATOM records): (download) 
    >6vmeY (Y:)
elyeevklyknarerekydnmaelfavvktmqalekayikdcvspseytaacsrllvqyk
aafrqvqgseissidefcrkfrldcplamerikedrpiti