PDB entry 6vlv

View 6vlv on RCSB PDB site
Description: Factor XIa in complex with compound 11
Class: blood clotting
Keywords: hydrolase, serine protease, coagulation factor, hydrolase-hydrolase inhibitor complex, blood clotting
Deposited on 2020-01-27, released 2020-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-05-06, with a file datestamp of 2020-05-01.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coagulation factor XIa light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: F11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03951 (0-End)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d6vlva_
  • Heterogens: R3A, FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6vlvA (A:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpislpskgdr
    nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
    kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav
    

    Sequence, based on observed residues (ATOM records): (download)
    >6vlvA (A:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpislpskgdr
    nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
    kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektq