PDB entry 6vhq

View 6vhq on RCSB PDB site
Description: Crystal structure of Bacillus subtilis levansucrase (D86A/E342A) in complex with oligosaccharides
Class: transferase
Keywords: Levansucrase, Transferase, Glycoside hydrolase, Levan, Fructose polymers
Deposited on 2020-01-10, released 2021-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-21, with a file datestamp of 2021-07-16.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoside hydrolase family 68 protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: sacB, B4417_3269, ETA10_18085, ETL41_09350, FVD40_16900
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0PFL2 (0-443)
      • engineered mutation (56)
      • engineered mutation (312)
      • expression tag (444-465)
    Domains in SCOPe 2.08: d6vhqa_
  • Chain 'B':
    Compound: Glycoside hydrolase family 68 protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: sacB, B4417_3269, ETA10_18085, ETL41_09350, FVD40_16900
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0PFL2 (0-443)
      • engineered mutation (56)
      • engineered mutation (312)
      • expression tag (444-465)
    Domains in SCOPe 2.08: d6vhqb_
  • Heterogens: CA, FRU, BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6vhqA (A:)
    ketnqkpyketygishitrhdmlqipeqqknekyqvpefdsstiknissakgldvwaswp
    lqnadgtvanyhgyhivfalagdpknaddtsiymfyqkvgetsidswknagrvfkdsdkf
    dandsilkdqtqewsgsatftsdgkirlfytdfsgkhygkqtlttaqvnvsasdsslnin
    gvedyksifdgdgktyqnvqqfidegnyssgdnhtlrdphyvedkghkylvfeantgted
    gyqgeeslfnkayygkstsffrqesqkllqsdkkrtaelangalgmielnddytlkkvmk
    pliasntvtdeiaranvfkmngkwylftdsrgskmtidgitsndiymlgyvsnsltgpyk
    plnktglvlkmdldpndvtftyshfavpqakgnnvvitsymtnrgfyadkqstfapsfll
    nikgkktsvvkdsileqgqltvnktdpnsssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6vhqA (A:)
    tnqkpyketygishitrhdmlqipeqqknekyqvpefdsstiknissakgldvwaswplq
    nadgtvanyhgyhivfalagdpknaddtsiymfyqkvgetsidswknagrvfkdsdkfda
    ndsilkdqtqewsgsatftsdgkirlfytdfsgkhygkqtlttaqvnvsasdsslningv
    edyksifdgdgktyqnvqqfidegnyssgdnhtlrdphyvedkghkylvfeantgtedgy
    qgeeslfnkayygkstsffrqesqkllqsdkkrtaelangalgmielnddytlkkvmkpl
    iasntvtdeiaranvfkmngkwylftdsrgskmtidgitsndiymlgyvsnsltgpykpl
    nktglvlkmdldpndvtftyshfavpqakgnnvvitsymtnrgfyadkqstfapsfllni
    kgkktsvvkdsileqgqltv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6vhqB (B:)
    ketnqkpyketygishitrhdmlqipeqqknekyqvpefdsstiknissakgldvwaswp
    lqnadgtvanyhgyhivfalagdpknaddtsiymfyqkvgetsidswknagrvfkdsdkf
    dandsilkdqtqewsgsatftsdgkirlfytdfsgkhygkqtlttaqvnvsasdsslnin
    gvedyksifdgdgktyqnvqqfidegnyssgdnhtlrdphyvedkghkylvfeantgted
    gyqgeeslfnkayygkstsffrqesqkllqsdkkrtaelangalgmielnddytlkkvmk
    pliasntvtdeiaranvfkmngkwylftdsrgskmtidgitsndiymlgyvsnsltgpyk
    plnktglvlkmdldpndvtftyshfavpqakgnnvvitsymtnrgfyadkqstfapsfll
    nikgkktsvvkdsileqgqltvnktdpnsssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6vhqB (B:)
    tnqkpyketygishitrhdmlqipeqqknekyqvpefdsstiknissakgldvwaswplq
    nadgtvanyhgyhivfalagdpknaddtsiymfyqkvgetsidswknagrvfkdsdkfda
    ndsilkdqtqewsgsatftsdgkirlfytdfsgkhygkqtlttaqvnvsasdsslningv
    edyksifdgdgktyqnvqqfidegnyssgdnhtlrdphyvedkghkylvfeantgtedgy
    qgeeslfnkayygkstsffrqesqkllqsdkkrtaelangalgmielnddytlkkvmkpl
    iasntvtdeiaranvfkmngkwylftdsrgskmtidgitsndiymlgyvsnsltgpykpl
    nktglvlkmdldpndvtftyshfavpqakgnnvvitsymtnrgfyadkqstfapsfllni
    kgkktsvvkdsileqgqltv