PDB entry 6vcq

View 6vcq on RCSB PDB site
Description: crystal structure of e.coli rpph in complex with gtp
Deposited on 2019-12-21, released 2020-02-05
The last revision was dated 2020-04-22, with a file datestamp of 2020-04-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA pyrophosphohydrolase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: rppH, nudH, ygdP, b2830, JW2798
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A776
      • engineered mutation (149-150)
  • Heterogens: GTP, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6vcqA (A:)
smidddgyrpnvgivicnrqgqvmwarrfgqhswqfpqgginpgesaeqamyrelfeevg
lsrkdvrilastrnwlryklpkrlvrwdtkpvcigqkqkwfllqlvsgdaeinmqtsstp
efdgwrwvsywypvrqvvsfkrdvyrrvmaafasvvmslqe

    Sequence, based on observed residues (ATOM records):
    >6vcqA (A:)
idddgyrpnvgivicnrqgqvmwarrfgqhswqfpqgginpgesaeqamyrelfeevgls
rkdvrilastrnwlryklpkrlvrwdtkpvcigqkqkwfllqlvsgdaeinmqtsstpef
dgwrwvsywypvrqvvsfkrdvyrrvmaafasvvmslq