PDB entry 6vco

View 6vco on RCSB PDB site
Description: crystal structure of e.coli rpph in complex with ppcpa
Deposited on 2019-12-21, released 2020-02-05
The last revision was dated 2020-04-22, with a file datestamp of 2020-04-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA pyrophosphohydrolase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: rppH, nudH, ygdP, b2830, JW2798
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A776 (1-160)
      • expression tag (0)
      • engineered mutation (159-160)
  • Heterogens: APC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6vcoA (A:)
smidddgyrpnvgivicnrqgqvmwarrfgqhswqfpqgginpgesaeqamyrelfeevg
lsrkdvrilastrnwlryklpkrlvrwdtkpvcigqkqkwfllqlvsgdaeinmqtsstp
efdgwrwvsywypvrqvvsfkrdvyrrvmkefasvvmslaa

    Sequence, based on observed residues (ATOM records):
    >6vcoA (A:)
smidddgyrpnvgivicnrqgqvmwarrfgqhswqfpqgginpgesaeqamyrelfeevg
lsrkdvrilastrnwlryklpkrlvrwkpvcigqkqkwfllqlvsgdaeinmqtsstpef
dgwrwvsywypvrqvvsfkrdvyrrvmkefasvvmslaa