PDB entry 6vba

View 6vba on RCSB PDB site
Description: Structure of human Uracil DNA Glycosylase (UDG) bound to Aurintricarboxylic acid (ATA)
Class: hydrolase
Keywords: glycosylase, DNA repair, uracil removal from DNA, alpha/ beta protein, glycosidase, hydrolase
Deposited on 2019-12-18, released 2021-03-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-16, with a file datestamp of 2021-06-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: uracil-DNA glycosylase
  Species: Homo sapiens [TaxId:9606]
  Gene: UNG, DGU, UNG1, UNG15
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13051 (3-222)
    • initiating methionine (0)
    • expression tag (1-2)
  Domains in SCOPe 2.08: d6vbaa1, d6vbaa2
• Heterogens: QU4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6vbaA (A:)
  meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
  lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
  llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
  hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel