PDB entry 6va5

View 6va5 on RCSB PDB site
Description: Tudor Domain of Tumor suppressor p53BP1 with MFP-4184
Class: transcription
Keywords: 53BP1, Tudor, MFP-4184, Structural Genomics, Structural Genomics Consortium, SGC, TRANSCRIPTION
Deposited on 2019-12-16, released 2020-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-04-29, with a file datestamp of 2020-04-24.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TP53-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53BP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6va5a1, d6va5a2
  • Heterogens: QSS, GOL, SO4, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6va5A (A:)
ggnsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipld
tevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqyg
lgpye

    Sequence, based on observed residues (ATOM records): (download) 
    >6va5A (A:)
nsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipldte
vtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqyglg
pye