PDB entry 6v7u

View 6v7u on RCSB PDB site
Description: structure of a phage-encoded quorum sensing anti-activator, aqs1
Deposited on 2019-12-09, released 2020-12-16
The last revision was dated 2021-06-30, with a file datestamp of 2021-06-25.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: quorum sensing anti-activator protein aqs1
    Species: Pseudomonas virus DMS3 [TaxId:389469]
    Gene: DMS3-3
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0SML3 (0-End)
      • engineered mutation (23-24)
  • Chain 'B':
    Compound: quorum sensing anti-activator protein aqs1
    Species: Pseudomonas virus DMS3 [TaxId:389469]
    Gene: DMS3-3
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0SML3 (0-End)
      • engineered mutation (23-24)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6v7uA (A:)
mtntdlkplldnlrnatefwnlvaaasatdestvhnrsyrdaldwlesaalalgdaliaq
rkavggdhe

    Sequence, based on observed residues (ATOM records):
    >6v7uA (A:)
mtntdlkplldnlrnatefwnlvaaasatdestvhnrsyrdaldwlesaalalgdaliaq
rka

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6v7uB (B:)
mtntdlkplldnlrnatefwnlvaaasatdestvhnrsyrdaldwlesaalalgdaliaq
rkavggdhe

    Sequence, based on observed residues (ATOM records):
    >6v7uB (B:)
mtntdlkplldnlrnatefwnlvaaasvhnrsyrdaldwlesaalalgdaliaqrka