PDB entry 6v7q

View 6v7q on RCSB PDB site
Description: Crystal structure of SUMO1 in complex with phosphorylated PIAS-SIM2
Class: peptide binding protein
Keywords: sumo1, pias, sumo interaction motif, peptide binding protein
Deposited on 2019-12-09, released 2020-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-04-01, with a file datestamp of 2020-03-27.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SUMO1, SMT3C, SMT3H3, UBL1, OK/SW-cl.43
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165
      • engineered mutation (37)
    Domains in SCOPe 2.07: d6v7qa_
  • Chain 'B':
    Compound: Protein PIAS
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6V7Q (Start-12)
  • Chain 'C':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SUMO1, SMT3C, SMT3H3, UBL1, OK/SW-cl.43
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165 (2-End)
      • engineered mutation (37)
    Domains in SCOPe 2.07: d6v7qc_
  • Chain 'D':
    Compound: Protein PIAS
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6V7Q (Start-12)
  • Heterogens: SEP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6v7qA (A:)
    gskegeyiklkvigqdsseihfkvkmtthlkklkesyaqrqgvpmnslrflfegqriadn
    htpkelgmeeedvievyqeqtgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6v7qA (A:)
    eyiklkvigqdsseihfkvkmtthlkklkesyaqrqgvpmnslrflfegqriadnhtpke
    lgmeeedvievyqeqt
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6v7qC (C:)
    gskegeyiklkvigqdsseihfkvkmtthlkklkesyaqrqgvpmnslrflfegqriadn
    htpkelgmeeedvievyqeqtgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6v7qC (C:)
    kegeyiklkvigqdsseihfkvkmtthlkklkesyaqrqgvpmnslrflfegqriadnht
    pkelgmeeedvievyqe
    

  • Chain 'D':
    No sequence available.