PDB entry 6v7p

View 6v7p on RCSB PDB site
Description: Crystal structure of SUMO1 in complex with PIAS-SIM2
Class: peptide binding protein
Keywords: sumo1, pias, sumo interaction motif, peptide binding protein
Deposited on 2019-12-09, released 2020-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-05-27, with a file datestamp of 2020-05-22.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SUMO1, SMT3C, SMT3H3, UBL1, OK/SW-cl.43
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165
      • engineered mutation (37)
    Domains in SCOPe 2.08: d6v7pa_
  • Chain 'B':
    Compound: Protein PIAS
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6V7P (Start-12)
  • Chain 'C':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SUMO1, SMT3C, SMT3H3, UBL1, OK/SW-cl.43
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165
      • engineered mutation (37)
    Domains in SCOPe 2.08: d6v7pc_
  • Chain 'D':
    Compound: Protein PIAS
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6V7P (Start-12)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6v7pA (A:)
    gskegeyiklkvigqdsseihfkvkmtthlkklkesyaqrqgvpmnslrflfegqriadn
    htpkelgmeeedvievyqeqtgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6v7pA (A:)
    yiklkvigqdsseihfkvkmtthlkklkesyaqrqgvpmnslrflfegqriadnhtpkel
    gmeeedvievyqeq
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6v7pC (C:)
    gskegeyiklkvigqdsseihfkvkmtthlkklkesyaqrqgvpmnslrflfegqriadn
    htpkelgmeeedvievyqeqtgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6v7pC (C:)
    eyiklkvigqdsseihfkvkmtthlkklkesyaqrqgvpmnslrflfegqriadnhtpke
    lgmeeedvievyqeqt
    

  • Chain 'D':
    No sequence available.