PDB entry 6v54

View 6v54 on RCSB PDB site
Description: Crystal Structure of Metallo Beta Lactamase from Hirschia baltica
Class: hydrolase
Keywords: hydrolase, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2019-12-03, released 2019-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Hirschia baltica (strain ATCC 49814 / DSM 5838 / IFAM 1418) [TaxId:582402]
    Gene: Hbal_3075
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6XID6 (Start-234)
      • engineered mutation (230)
    Domains in SCOPe 2.07: d6v54a_
  • Heterogens: MG, FMT, EDO, CL, ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6v54A (A:)
    snaqseqsthiegvaekpvefvklgtgvwmhtgykvvppwgnirtngliiergdysvlvd
    tawndaqtaeivawakdtlqkpirasihthahsdkmggmdalhmlgvetfatdltnrlai
    erglmpaknvlniseigsqiewegltilypggghsednivvnegvnnilfggcmirpgmt
    tslgniddanlgywskavenaanafpdsqivipshgkpagreilkntayitrpkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6v54A (A:)
    kpvefvklgtgvwmhtgykvvppwgnirtngliiergdysvlvdtawndaqtaeivawak
    dtlqkpirasihthahsdkmggmdalhmlgvetfatdltnrlaierglmpaknvlnisei
    gsqiewegltilypggghsednivvnegvnnilfggcmirpgmttslgniddanlgywsk
    avenaanafpdsqivipshgkpagreilkntayitrpkl