PDB entry 6v4t

View 6v4t on RCSB PDB site
Description: mper-tmd of hiv-1 env bound with the entry inhibitor s2c3
Deposited on 2019-11-30, released 2020-04-01
The last revision was dated 2020-05-06, with a file datestamp of 2020-05-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: envelope glycoprotein gp160
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: ENV
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q74849 (0-50)
• Chain 'B':
  Compound: envelope glycoprotein gp160
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: ENV
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q74849 (0-50)
• Chain 'C':
  Compound: envelope glycoprotein gp160
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: ENV
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q74849 (0-50)
• Heterogens: QOJ

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6v4tA (A:)
  lleldkwaslwnwfditnwlwyirifiiivgsliglrivfavlslvnrvrq
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6v4tB (B:)
  lleldkwaslwnwfditnwlwyirifiiivgsliglrivfavlslvnrvrq
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >6v4tC (C:)
  lleldkwaslwnwfditnwlwyirifiiivgsliglrivfavlslvnrvrq