PDB entry 6v2s

View 6v2s on RCSB PDB site
Description: crystal structure of chromodomain of mpp8 in complex with inhibitor unc3866
Deposited on 2019-11-25, released 2019-12-25
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-24.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: M-phase phosphoprotein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: MPHOSPH8, MPP8
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: M-phase phosphoprotein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: MPHOSPH8, MPP8
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: unc3866
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6V2S (0-5)
  • Chain 'D':
    Compound: unc3866
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6V2S (0-5)
  • Heterogens: UNX, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6v2sA (A:)
gedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk
ak

    Sequence, based on observed residues (ATOM records):
    >6v2sA (A:)
edvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenka

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6v2sB (B:)
gedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk
ak

    Sequence, based on observed residues (ATOM records):
    >6v2sB (B:)
dvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenkak

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6v2sC (C:)
xfalxx

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >6v2sD (D:)
xfalxx