PDB entry 6v1e

View 6v1e on RCSB PDB site
Description: Crystal structure of the bromodomain of human BRD7 bound to BI7273
Class: gene regulation
Keywords: BRD4, BRD, inhibitor, BI7273, GENE REGULATION
Deposited on 2019-11-20, released 2020-03-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-08, with a file datestamp of 2020-04-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD7, BP75, CELTIX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6v1ea_
  • Heterogens: 5SW, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6v1eA (A:)
gaaseeveqtplqealnqlmrqlqrkdpsaffsfpvtdfiapgysmiikhpmdfstmkek
iknndyqsieelkdnfklmctnamiynkpetiyykaakkllhsgmkilsqeriqslkqsi
dfmadl

    Sequence, based on observed residues (ATOM records): (download) 
    >6v1eA (A:)
eqtplqealnqlmrqlqrkdpsaffsfpvtdfiapgysmiikhpmdfstmkekiknndyq
sieelkdnfklmctnamiynkpetiyykaakkllhsgmkilsqeriqslkqsidfmadl