PDB entry 6uz4

View 6uz4 on RCSB PDB site
Description: Solution structure of AGL55-Kringle 2 complex
Class: protein binding
Keywords: Plasminogen binding peptide, PROTEIN BINDING
Deposited on 2019-11-14, released 2020-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-12-09, with a file datestamp of 2020-12-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasminogen
    Species: Homo sapiens [TaxId:9606]
    Gene: PLG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00747 (7-84)
      • expression tag (5-6)
      • engineered mutation (10)
      • engineered mutation (62)
      • engineered mutation (78)
    Domains in SCOPe 2.08: d6uz4a1, d6uz4a2
  • Chain 'B':
    Compound: m protein
    Species: Streptococcus pyogenes NS88.2 [TaxId:1138874]
    Gene: emm
    Database cross-references and differences (RAF-indexed):
    • Uniprot M4I022 (2-56)
      • expression tag (0-1)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6uz4A (A:)
yvefseecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnp
drdlrpwcfttdpnkrweycdiprcaa

    Sequence, based on observed residues (ATOM records): (download) 
    >6uz4A (A:)
eecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdrdlr
pwcfttdpnkrweycdiprc

  • Chain 'B':
    No sequence available.