PDB entry 6uyy

View 6uyy on RCSB PDB site
Description: Crystal structure of K39-acetylated SUMO1 in complex with phosphorylated DAXX
Class: nuclear protein/protein binding
Keywords: SUMO1, PML, SUMO INTERACTION MOTIF, PHOSPHOSIM, NUCLEAR PROTEIN-PROTEIN BINDING complex
Deposited on 2019-11-14, released 2019-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SUMO1, SMT3C, SMT3H3, UBL1, OK/SW-cl.43
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165 (Start-82)
      • engineered mutation (37)
    Domains in SCOPe 2.07: d6uyya_
  • Chain 'B':
    Compound: phosphorylated DAXX
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6UYY
  • Heterogens: ALY, SEP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6uyyA (A:)
    gskegeyiklkvigqdsseihfkvkmtthlkklkesyaqrqgvpmnslrflfegqriadn
    htpkelgmeeedvievyqeqtgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6uyyA (A:)
    geyiklkvigqdsseihfkvkmtthlkklkesyaqrqgvpmnslrflfegqriadnhtpk
    elgmeeedvievyqeqtgg
    

  • Chain 'B':
    No sequence available.