PDB entry 6ux5

View 6ux5 on RCSB PDB site
Description: structure of acrorhagin i from the sea anemone actinia equina
Deposited on 2019-11-06, released 2020-11-18
The last revision was dated 2021-06-02, with a file datestamp of 2021-05-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U-actitoxin-Aeq5a
    Species: Actinia equina [TaxId:6106]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ux5A (A:)
    sstpdgtwvkcrhdcftkykscqmsdschdeqschqchvkhtdcvntgcp